PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.09G014100.1.p
Common NameGLYMA_09G014100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YB
Protein Properties Length: 178aa    MW: 19732 Da    PI: 6.9612
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.09G014100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB188.16.1e-5925120297
                NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                          reqdrflPianvsrimkk+lPanakisk+aketvqecvsefisf+t+easdkcq+ekrktingddllwa++tlGfedyv+plk+yl+kyr
  Glyma.09G014100.1.p  25 REQDRFLPIANVSRIMKKALPANAKISKEAKETVQECVSEFISFITGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVDPLKIYLHKYR 114
                          89**************************************************************************************** PP

                NF-YB  92 elegek 97 
                          e+egek
  Glyma.09G014100.1.p 115 EMEGEK 120
                          ****97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.0E-5521137IPR009072Histone-fold
SuperFamilySSF471132.48E-4227133IPR009072Histone-fold
PfamPF008083.6E-283094IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.6E-205876No hitNo description
PROSITE patternPS0068506177IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.6E-207795No hitNo description
PRINTSPR006151.6E-2096114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MAESDNESGG HTGNASGSNE LSGCREQDRF LPIANVSRIM KKALPANAKI SKEAKETVQE  60
CVSEFISFIT GEASDKCQKE KRKTINGDDL LWAMTTLGFE DYVDPLKIYL HKYREMEGEK  120
TAMMGRPHER DEGYGHGHGH ATPMMTMMMG HQPQHQHQHQ HQGHVYGSGS ASSARTR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B3e-4925115292Transcription factor HapC (Eurofung)
4g91_B3e-4925115292Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.258280.0hypocotyl
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0893460.0BT089346.1 Soybean clone JCVI-FLGm-1B8 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001238398.11e-115uncharacterized protein LOC100305641
SwissprotO233102e-73NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A0B2S2581e-133A0A0B2S258_GLYSO; Nuclear transcription factor Y subunit B-3
TrEMBLI1L0371e-133I1L037_SOYBN; Uncharacterized protein
STRINGGLYMA09G01650.11e-132(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-73nuclear factor Y, subunit B3